DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and Elovl5

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_030100414.1 Gene:Elovl5 / 68801 MGIID:1916051 Length:340 Species:Mus musculus


Alignment Length:280 Identity:101/280 - (36%)
Similarity:153/280 - (54%) Gaps:19/280 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DEFKTHHITRNYTGLVQRYYQLVEEDYG--DPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFM 88
            |.||..|    :...:..|::..   .|  |.|.|.:.|:::.:.||....:|| .::.:||.:|
Mouse    38 DRFKMEH----FDASLSTYFKAF---LGPRDTRVKGWFLLDNYIPTFVCSVIYL-LIVWLGPKYM 94

  Fly    89 RDRKPFQLRRTLVVYNAFQVALSGYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYY 153
            ::|:||..|..|.:||.....||.|||||.:...|...||..||.. .|...|..:::.:.:.||
Mouse    95 KNRQPFSCRGILQLYNLGLTLLSLYMFYELVTGVWEGKYNFFCQGT-RSAGESDMKIIRVLWWYY 158

  Fly   154 LSKLTEFADTMFFVLRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYF 218
            .|||.||.||.||:|||.:.|||.||||||:......|.::.::..|::.|...||:|:||.||.
Mouse   159 FSKLIEFMDTFFFILRKNNHQITVLHVYHHATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYS 223

  Fly   219 YYMMAAMGPEYAKFLWWKKYMTELQIAQFVLCIFHTLRALFSNQCQFS---KFISALLLLNASIF 280
            ||.:::: |....:||||||:|:.|:.||||.|..|...:|. .|.|.   .|.....:::   .
Mouse   224 YYGLSSI-PSMRPYLWWKKYITQGQLVQFVLTIIQTTCGVFW-PCSFPLGWLFFQIGYMIS---L 283

  Fly   281 FCLFMNFYMQSYRKTKAAQQ 300
            ..||.|||:|:|.|..|:::
Mouse   284 IALFTNFYIQTYNKKGASRR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 90/235 (38%)
Elovl5XP_030100414.1 ELO 68..302 CDD:366492 92/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.