DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and Elovl1

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001037740.1 Gene:Elovl1 / 679532 RGDID:1587151 Length:279 Species:Rattus norvegicus


Alignment Length:299 Identity:120/299 - (40%)
Similarity:174/299 - (58%) Gaps:24/299 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LVQRYYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYN 104
            :|..|.:|::  ..|||.:.:|||..|:....::..|:.:||.:||..|.:|||||||..::|||
  Rat     4 VVNLYQELMK--CADPRIQNYPLMGSPLLITSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYN 66

  Fly   105 AFQVALSGYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLR 169
            ...|.||.|:.||.||:|||:.|..:|.|||:|::|.:.||:.:.:|:.|||:.|..||:.|:||
  Rat    67 FSLVTLSLYIVYEFLMSGWLSTYTWRCDPVDFSNNPEALRMVRVAWLFMLSKVIELMDTVIFILR 131

  Fly   170 KKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLW 234
            ||..|:|:|||:||||.|...|..:|...||..:|..::|:.|||.||.||.::|:||....:||
  Rat   132 KKDGQVTFLHVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYLW 196

  Fly   235 WKKYMTELQIAQFVLCIFHTLRALFSNQCQFS-KFISALLLLNASIFFCLFMNFYMQSYRKTKAA 298
            |||:||.:|:.||||...|..:..|...|.:. ..|..|:.:..:|||.||.||:..||.|.|..
  Rat   197 WKKHMTAIQLIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYGTIFFILFSNFWYHSYTKGKRL 261

  Fly   299 QQLQQQQQQQKQQQQLDATPCKADSNNNTAMLAQKLKAN 337
            .:..||                     |.|..:.|:|||
  Rat   262 PRAVQQ---------------------NGAAASMKVKAN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 104/233 (45%)
Elovl1NP_001037740.1 ELO 23..260 CDD:395916 105/236 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.