DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and elovl2

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_005162628.1 Gene:elovl2 / 678614 ZFINID:ZDB-GENE-060421-5612 Length:295 Species:Danio rerio


Alignment Length:258 Identity:98/258 - (37%)
Similarity:148/258 - (57%) Gaps:18/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LVEEDYG--DPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYNAFQVA 109
            :|:..:|  |.|.:.:.|::....||.:...|| ..:.:|..:||:|..:.|:..|::||.....
Zfish    14 VVDSLFGERDTRVRGWLLLDSYTPTFLLTITYL-LTIYLGTKYMRNRPAYSLKNVLLLYNFSVTV 77

  Fly   110 LSGYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKSSQ 174
            ||.||..|.:.|.|...|.|:||.:| ....:..|:..:.:.||.|||.||.||:|.|||||:||
Zfish    78 LSFYMLVELISAVWSAGYRLQCQALD-EVGEADIRVAKVLWWYYFSKLIEFLDTIFIVLRKKNSQ 141

  Fly   175 ITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLWWKKYM 239
            |::||||||:......|.::.::..|.:.|...||:|:||.||.||.:|.: |...|:||||:|:
Zfish   142 ISFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHVLMYSYYGLATI-PSMHKYLWWKRYL 205

  Fly   240 TELQIAQFVLCIFHTLRAL-----FSNQC-QFSKFISALLLLNASIFFCLFMNFYMQSYRKTK 296
            |:.|:.||||.|.||:.|.     |...| :|..|....|::       ||:|||:|:|:|.|
Zfish   206 TQAQLVQFVLTITHTVSAWVVPCGFPLGCLKFQTFYMCTLVV-------LFVNFYIQTYKKRK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 92/238 (39%)
elovl2XP_005162628.1 ELO 31..262 CDD:279492 94/241 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.