DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and ELOVL5

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001229757.1 Gene:ELOVL5 / 60481 HGNCID:21308 Length:326 Species:Homo sapiens


Alignment Length:297 Identity:98/297 - (32%)
Similarity:144/297 - (48%) Gaps:61/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYNAFQVALSGYMFYE- 117
            |.|.|.:.|:::.:.||....:|| .::.:||.:||:::||..|..|||||.....||.|||.| 
Human    20 DTRVKGWFLLDNYIPTFICSVIYL-LIVWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCES 83

  Fly   118 -------------------------HLMAG-WLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSK 156
                                     .|:.| |...||..||.. .:...|..:::.:.:.||.||
Human    84 KREQPRRSACASRTDPSTQQQLPENRLVTGVWEGKYNFFCQGT-RTAGESDMKIIRVLWWYYFSK 147

  Fly   157 LTEFADTMFFVLRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYM 221
            |.||.||.||:|||.:.|||.||||||:......|.::.::..|::.|...||:|:||.||.||.
Human   148 LIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYG 212

  Fly   222 MAAMGPEYAKFLWWKKYMTELQIAQFVLCIFHTLRALFSNQC---------------QFSKFISA 271
            :::: |....:||||||:|:.|:.||||.|..|       .|               |....||.
Human   213 LSSV-PSMRPYLWWKKYITQGQLLQFVLTIIQT-------SCGVIWPCTFPLGWLYFQIGYMISL 269

  Fly   272 LLLLNASIFFCLFMNFYMQSYRKTKAAQQLQQQQQQQ 308
            :         .||.|||:|:|.|..|:::....:..|
Human   270 I---------ALFTNFYIQTYNKKGASRRKDHLKDHQ 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 92/274 (34%)
ELOVL5NP_001229757.1 ELO 27..288 CDD:366492 94/279 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.