DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and elovl6

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001017257.2 Gene:elovl6 / 550011 XenbaseID:XB-GENE-942876 Length:265 Species:Xenopus tropicalis


Alignment Length:285 Identity:80/285 - (28%)
Similarity:135/285 - (47%) Gaps:43/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NYTGLVQRYYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTL 100
            |.:.|..:.|:. |:.:.:..|.:: :.|:...:|...|:|.:::.. |...|:.|:.|:||:.|
 Frog     2 NMSALTLQEYEF-EKQFNENEAIQW-MQENWKKSFLFSALYAAFIFG-GRHLMKQREKFELRKPL 63

  Fly   101 V-------VYNAFQVALSG-YMFYEHLMAGWLNYYNLKCQPVDYS--DSPSSKRMLNLCYLYYLS 155
            :       |::.|....:| ||.|..:..|      ||....|.|  ..|.||..   .|.:.||
 Frog    64 ILWSLSLAVFSIFGAVRTGAYMLYILMTKG------LKQSVCDQSFYYGPVSKFW---AYAFVLS 119

  Fly   156 KLTEFADTMFFVLRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYY 220
            |..|..||:|.:|||:  ::.:||.|||....|.:|...|.:..|...|.. :|..||..||.||
 Frog   120 KAPELGDTIFIILRKQ--KLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMT-MNYGVHAVMYSYY 181

  Fly   221 MMAAMGPEYAKFLWWKKY---MTELQIAQFVL-CIFHTLRALFSNQCQFSKFI-----SALLLLN 276
            .:.|.|     |...:|:   :|..||.|.:: |:.:.|...:..|.|....:     |:::.|:
 Frog   182 ALRAAG-----FRVSRKFAMLITLSQITQMIIGCVVNYLVFSWMQQGQCPSHVQNIVWSSIMYLS 241

  Fly   277 ASIFFCLFMNFYMQSY-RKTKAAQQ 300
               :|.||.:|:.::| .||:.|.:
 Frog   242 ---YFVLFCHFFFEAYITKTRKASK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 72/252 (29%)
elovl6NP_001017257.2 ELO 25..262 CDD:366492 74/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.