DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and elovl1

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001016644.1 Gene:elovl1 / 549398 XenbaseID:XB-GENE-1014374 Length:290 Species:Xenopus tropicalis


Alignment Length:256 Identity:117/256 - (45%)
Similarity:166/256 - (64%) Gaps:5/256 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VQRYYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYNA 105
            ||:|:..::.  .|.|...:|||:.|.....::..|:.:||.:||..|.:||||.|:..:||||.
 Frog     9 VQKYHNFMKG--ADSRIYDYPLMQSPFLPGAILLSYVYFVLSLGPRIMANRKPFDLKPLMVVYNF 71

  Fly   106 FQVALSGYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRK 170
            ..||||.|:.||.||:|||..|..:|.|||.||:|.:.||:.:.:|:..||..|..||:|||:||
 Frog    72 SLVALSAYIVYEFLMSGWLTGYTWRCDPVDVSDTPMALRMVRVAWLFLFSKFIELLDTVFFVVRK 136

  Fly   171 KSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLWW 235
            |:||||:||::||||.|...|..|||..||..:|..::|:.|||.|||||.::|.||.:.|:|||
 Frog   137 KNSQITFLHIFHHSVLPWSWWWGVKFGPGGMGSFHAMINSLVHVIMYFYYGLSAAGPRFQKYLWW 201

  Fly   236 KKYMTELQIAQFVLCIFHTLRALFSNQC--QFSKFISALLLLNASIFFCLFMNFYMQSYRK 294
            ||:||.:|:.||||...|..:..|.:.|  |:..||. |:.:..::||.||.||:.|:|.|
 Frog   202 KKHMTAIQLIQFVLVSIHISQYYFMSSCDYQYPIFIH-LIWIYGTVFFILFSNFWYQAYTK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 111/234 (47%)
elovl1NP_001016644.1 ELO 27..267 CDD:395916 112/236 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.