DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and ELOVL2

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_011513018.1 Gene:ELOVL2 / 54898 HGNCID:14416 Length:326 Species:Homo sapiens


Alignment Length:260 Identity:96/260 - (36%)
Similarity:148/260 - (56%) Gaps:24/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DPRAKRFPLMEHPMFTFGMVAVYL--SWVLVIGPLFMRDRKPFQLRRTLVVYNAFQVALSGYMFY 116
            |.|.:.:.:::..:.||.:..:||  .|   :|..:|::|....||..|.:||.....||.||..
Human    53 DSRVRGWFMLDSYLPTFFLTVMYLLSIW---LGNKYMKNRPALSLRGILTLYNLGITLLSAYMLA 114

  Fly   117 EHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKSSQITWLHVY 181
            |.:::.|...|||:||.:. |...:..|:..:.:.||.||..||.||:|||||||:||||:||||
Human   115 ELILSTWEGGYNLQCQDLT-SAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVY 178

  Fly   182 HHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLWWKKYMTELQIAQ 246
            ||:......|.::.::..|.:.|...||:|:|:.||.||.::.. |...|:||||||:|:.|:.|
Human   179 HHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVF-PSMHKYLWWKKYLTQAQLVQ 242

  Fly   247 FVLCIFHTLRALFSNQCQF--------SKFISALLLLNASIFFCLFMNFYMQSYRKTKAAQQLQQ 303
            |||.|.||:.|:. ..|.|        |.::..|::        ||:|||:|:|||....:.:|:
Human   243 FVLTITHTMSAVV-KPCGFPFGCLIFQSSYMLTLVI--------LFLNFYVQTYRKKPMKKDMQE 298

  Fly   304  303
            Human   299  298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 91/242 (38%)
ELOVL2XP_011513018.1 ELO 60..294 CDD:279492 93/247 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.