DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and elovl2

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001016159.1 Gene:elovl2 / 548913 XenbaseID:XB-GENE-489753 Length:296 Species:Xenopus tropicalis


Alignment Length:286 Identity:100/286 - (34%)
Similarity:155/286 - (54%) Gaps:46/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DPRAKRFPLMEHPMFTFGMVAVY-LS-WVLVIGPLFMRDRKPFQLRRTLVVYNAFQVALSGYMFY 116
            |.|.:.:.:::..:.|..:..:| || |   :|..:|::|..|.||..|:|||.....||.||..
 Frog    23 DTRTRGWLMLDSYLPTLFLTLLYFLSIW---LGTKYMQNRPAFSLRGHLIVYNLVVTLLSLYMLI 84

  Fly   117 EHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKSSQITWLHVY 181
            |.:::.|...|||:||.:| |...:..|:..:.:.||.||..||.||:|||||||:||||:||||
 Frog    85 ELILSTWEGGYNLQCQNLD-SAGKADVRVAKVLWWYYFSKAIEFMDTIFFVLRKKNSQITFLHVY 148

  Fly   182 HHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLWWKKYMTELQIAQ 246
            ||:......|.::.::..|.:.|...||:|:||.||.||.::.: |...|:||||:|:|:.|:.|
 Frog   149 HHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHVLMYSYYGLSVI-PSMHKYLWWKRYLTQAQLVQ 212

  Fly   247 FVLCIFHTLRALFSNQCQF--------SKFISALLLLNASIFFCLFMNFYMQSYRKTKAAQQLQQ 303
            |:|.|.|||.|.. ..|.|        :.:::.|::        ||:|||:::|:|         
 Frog   213 FLLTITHTLSAAV-KPCGFPFGCLMFQASYMATLVI--------LFVNFYLKTYKK--------- 259

  Fly   304 QQQQQKQQQQLDATPCKADSNNNTAM 329
                         .|.|:|.|...|:
 Frog   260 -------------RPSKSDPNGIPAL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 92/242 (38%)
elovl2NP_001016159.1 ELO 49..263 CDD:366492 90/249 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.