DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and Elovl2

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_062296.1 Gene:Elovl2 / 54326 MGIID:1858960 Length:292 Species:Mus musculus


Alignment Length:262 Identity:100/262 - (38%)
Similarity:151/262 - (57%) Gaps:24/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DPRAKRFPLMEHPMFTFGMVAVYL--SWVLVIGPLFMRDRKPFQLRRTLVVYNAFQVALSGYMFY 116
            |.|.:.:.|::..:.||.:...||  .|   :|..:|::|....||..|.:||.....||.||..
Mouse    23 DSRVRGWFLLDSYLPTFILTITYLLSIW---LGNKYMKNRPALSLRGILTLYNLAITLLSAYMLV 84

  Fly   117 EHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKSSQITWLHVY 181
            |.:::.|...|||:||.:| |......|:..:.:.||.|||.||.||:|||||||::|||:||||
Mouse    85 ELILSSWEGGYNLQCQNLD-SAGEGDVRVAKVLWWYYFSKLVEFLDTIFFVLRKKTNQITFLHVY 148

  Fly   182 HHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLWWKKYMTELQIAQ 246
            ||:......|.::.::..|.:.|...||:|:|:.||.||.::.. |...|:||||||:|:.|:.|
Mouse   149 HHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVF-PSMHKYLWWKKYLTQAQLVQ 212

  Fly   247 FVLCIFHTLRALFSNQCQF--------SKFISALLLLNASIFFCLFMNFYMQSYRKTKAAQQLQQ 303
            |||.|.|||.|:. ..|.|        |.::..|::        ||:|||:|:|||....::||:
Mouse   213 FVLTITHTLSAVV-KPCGFPFGCLIFQSSYMMTLVI--------LFLNFYIQTYRKKPVKKELQE 268

  Fly   304 QQ 305
            ::
Mouse   269 KE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 94/242 (39%)
Elovl2NP_062296.1 ELO 30..264 CDD:307345 96/247 (39%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03202 289..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.