DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and elovl5

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001011248.1 Gene:elovl5 / 496694 XenbaseID:XB-GENE-952346 Length:295 Species:Xenopus tropicalis


Alignment Length:287 Identity:99/287 - (34%)
Similarity:155/287 - (54%) Gaps:40/287 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYNAFQVALSGYMFYEH 118
            |||.:.:.|:::.:.|....|:|| :::..||.:|::|.|...|..|||||.....||.|||||.
 Frog    20 DPRVRGWLLLDNYVPTILFTALYL-FIVWRGPKYMQNRPPVSCRGILVVYNLGLTLLSLYMFYEL 83

  Fly   119 LMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKSSQITWLHVYHH 183
            :...|...||..||..: |...:..:::.:.:.||.|||.||.||.||:|||.:.|||.||||||
 Frog    84 VTGVWEGGYNFFCQDTN-SGGDADTKIVRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHH 147

  Fly   184 SVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLWWKKYMTELQIAQFV 248
            :......|.::.::..|::.|...||:|:||.||.||.::|: |....:||||||:|:.|:.|||
 Frog   148 ASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSAI-PAMRPYLWWKKYITQCQLTQFV 211

  Fly   249 LCIFHTLRALFSNQCQF--------SKFISALLLLNASIFFCLFMNFYMQSYRK----------- 294
            |.:..|..|:.. .|:|        :.::.:|::        ||.|||:::|.|           
 Frog   212 LTMTQTTCAMIW-PCKFPMGWLYFQNCYMISLII--------LFGNFYIKTYNKKTSSRRKEYQN 267

  Fly   295 ---------TKAAQQLQQQQQQQKQQQ 312
                     |.:...|:...:|:||:|
 Frog   268 GSASAVNGHTNSFSSLEDNVKQRKQRQ 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 89/240 (37%)
elovl5NP_001011248.1 ELO 28..261 CDD:366492 90/244 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..295 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.