DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and bond

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster


Alignment Length:270 Identity:108/270 - (40%)
Similarity:159/270 - (58%) Gaps:27/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YYQLVEEDYG------DPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVV 102
            |.::|||...      |.....:.||..||....:|.|||::||.|||.:|::|||..|:|.:|.
  Fly     4 YIKIVEERISGLSKGVDETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVF 68

  Fly   103 YNAFQVALSGYMF-----YEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNL-----CYLYYLSKL 157
            ||||||..|.:|.     ..::||   :.::.||:       .:..|..||     .:.|:.||:
  Fly    69 YNAFQVLYSIWMCRTSIQESNVMA---SIFSKKCE-------INRTREQNLTLYSGAWFYFFSKI 123

  Fly   158 TEFADTMFFVLRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMM 222
            .:..||.|||||||.:|:::||||||::|.|.:|..:|:..|.......:||:.||:.||||||:
  Fly   124 IDLLDTTFFVLRKKDNQVSFLHVYHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMV 188

  Fly   223 AAMGPEYAKFLWWKKYMTELQIAQFVLCIFHTLRALFSNQCQFSKFISALLLLNASIFFCLFMNF 287
            |||||:|.|:||||||||.:|:.||||.:.:.| .:.:..|...|.::...:.|..||..||.||
  Fly   189 AAMGPQYQKYLWWKKYMTSIQLIQFVLILGYML-TVGAKGCNMPKTLTFFFVGNTVIFLYLFGNF 252

  Fly   288 YMQSYRKTKA 297
            |.::|:|.|:
  Fly   253 YRKTYKKAKS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 101/242 (42%)
bondNP_651062.3 ELO 27..262 CDD:279492 102/245 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449582
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28030
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1110.910

Return to query results.
Submit another query.