DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and CG5326

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster


Alignment Length:262 Identity:125/262 - (47%)
Similarity:172/262 - (65%) Gaps:1/262 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TGLVQRYYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVV 102
            |.:|.|......| :.|.|.|::.|...|...|.::..||.:.|..||.:|||||||:|:.||:|
  Fly     9 TTIVDRMVNFFVE-HEDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLV 72

  Fly   103 YNAFQVALSGYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFV 167
            |||.||.||..:|||....||..:||.|||||.|...|.|.||....:|||::|:||..||:|||
  Fly    73 YNAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFFV 137

  Fly   168 LRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKF 232
            ||||..||::||:|||::.|:..::.||:.|||:.|....:|:|:|:.||.||:::||||:..|:
  Fly   138 LRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKY 202

  Fly   233 LWWKKYMTELQIAQFVLCIFHTLRALFSNQCQFSKFISALLLLNASIFFCLFMNFYMQSYRKTKA 297
            ||||||:|.|||.||::...|||:..|...|.|.|.|:|||..||.:|..:|..||:.:|:|..|
  Fly   203 LWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFTYMFSAFYVANYKKEAA 267

  Fly   298 AQ 299
            ||
  Fly   268 AQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 114/232 (49%)
CG5326NP_651060.1 ELO 31..262 CDD:395916 113/230 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449579
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.