DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and CG9459

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_649958.2 Gene:CG9459 / 41213 FlyBaseID:FBgn0037764 Length:265 Species:Drosophila melanogaster


Alignment Length:260 Identity:90/260 - (34%)
Similarity:142/260 - (54%) Gaps:27/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PRAKRFPLMEH--PMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYNAFQVALSGYM--F 115
            |...|.||...  |:.|  ::.:||.::.::||.||:::||:.|.|.:.:||..|:|.:..:  |
  Fly    14 PDPVRLPLTSSHWPVLT--ILGIYLVFIKIVGPWFMQNQKPYNLDRAIKIYNIVQIAYNVILLIF 76

  Fly   116 YEHLMAGWLNYYNLKC---QPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKSSQITW 177
            ..|.|.|..| ||..|   .|:|: :..:.:|.|:  |.|:.:||.:..:|:||:.|||..||::
  Fly    77 SVHFMLGPGN-YNFSCISNLPLDH-EYKNWERWLS--YSYFFNKLMDLLETVFFIFRKKYRQISF 137

  Fly   178 LHVYHHSVTPLETWVLVKFL------AGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLWWK 236
            |||:||..     .|.:.||      .||:..|....|..||..||.||..:::.......||||
  Fly   138 LHVFHHVY-----MVYIGFLYMYYYGYGGHGFFLITFNVVVHTMMYTYYYQSSLNRNSGGDLWWK 197

  Fly   237 KYMTELQIAQFVLCIFHTLRALFSNQCQFSKFISALLLLNASIFFCLFMNFYMQSY---RKTKAA 298
            ||:|.:|:.|||:...|::..|....||.|:..:....|.:.:|..||.|||:::|   :|||:|
  Fly   198 KYITVVQLVQFVIIFSHSVYILRQTDCQTSRLSATWGSLISVVFIILFSNFYVRTYILPKKTKSA 262

  Fly   299  298
              Fly   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 84/248 (34%)
CG9459NP_649958.2 ELO 20..261 CDD:279492 86/251 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449588
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.