DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and CG16904

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster


Alignment Length:255 Identity:82/255 - (32%)
Similarity:131/255 - (51%) Gaps:6/255 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYNAFQVA 109
            :::.::.:.||  .:.||......:..::.|||.:||.:|...|...:..|||..|..||..||.
  Fly     2 FEVFDKPFADP--VQLPLAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVL 64

  Fly   110 LSGYMFY--EHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKS 172
            .:..:|.  .||:. ....|||.|..|...|.........|.|:|:|:|:.:..||:|||||||.
  Fly    65 FNSVIFVWGIHLLF-VQKPYNLSCMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQ 128

  Fly   173 SQITWLHVYHHSVTPLETWVLVKFLA-GGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLWWK 236
            .|||:|||:||......:.:|::|.. ||:.....:.|..||:.||.||..::......:.||||
  Fly   129 RQITFLHVFHHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWK 193

  Fly   237 KYMTELQIAQFVLCIFHTLRALFSNQCQFSKFISALLLLNASIFFCLFMNFYMQSYRKTK 296
            ||:|..|:.||:|...|.:...|...|..|:.:..::...::..|.:|..||:::|.:.|
  Fly   194 KYLTLGQLVQFLLMFLHCMYTYFQPNCSASRGVIYVISSASAFMFLMFTKFYIKTYIRPK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 79/235 (34%)
CG16904NP_649957.1 ELO 16..257 CDD:279492 80/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449585
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.