DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and CG8534

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster


Alignment Length:265 Identity:90/265 - (33%)
Similarity:144/265 - (54%) Gaps:26/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYNAFQVALS 111
            ::.||     ..|.||:..|..:..:|::||.:||.:|..||.:|||:.|||.:..||..|:..:
  Fly    10 IISED-----PVRLPLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYN 69

  Fly   112 GYMFYEHLMAGW-----LNYYNLKC---QPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVL 168
            |.:    |:||.     |..|:|:|   .|:|: :..|.:|.|.  |.|:.:|..:..:|:||||
  Fly    70 GVI----LIAGLHFLFVLKAYDLRCITKLPLDH-ELKSRERWLT--YSYFFNKFMDLLETVFFVL 127

  Fly   169 RKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFP-NLLNNFVHVCMYFYYMMAAMGPEYAKF 232
            |||..||::|||:||.|.....::.:.|...|...|| .|||..|||.||.||.::::..: .:.
  Fly   128 RKKDRQISFLHVFHHLVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKD-VQT 191

  Fly   233 LWWKKYMTELQIAQFVLCIFHTLRALFSNQCQFSKFISALLLLNASIFFCLFMNFYMQSY----R 293
            ..||||:|.:|:.||:|.:.:....|....|..|:.:....:..::.|..:|.|||:.:|    .
  Fly   192 SRWKKYITIVQLVQFILVLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYILNGS 256

  Fly   294 KTKAA 298
            |.|:|
  Fly   257 KQKSA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 84/245 (34%)
CG8534NP_649955.1 ELO 19..259 CDD:366492 85/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449580
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.