DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and CG18609

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster


Alignment Length:268 Identity:91/268 - (33%)
Similarity:143/268 - (53%) Gaps:15/268 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RYYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYNAFQ 107
            ||.::.:   .||..  .||...|.....::..||.:||.:|.:|||:|||:.|:..|.|||.||
  Fly     3 RYLRIPQ---ADPNP--IPLAGSPWPITLILIAYLLFVLKLGKIFMRNRKPYDLKTVLKVYNLFQ 62

  Fly   108 VALS----GYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVL 168
            |..:    |.:||...:.|..|.:.::..|..: :....:|:|:..||  |:|:.:..||:||||
  Fly    63 VLYNGLYFGMVFYYLFIVGICNLHCIESFPEGH-ERKQLERVLHAAYL--LNKVLDLMDTVFFVL 124

  Fly   169 RKKSSQITWLHVYHHSVTPLETWVLVKFL-AGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKF 232
            ||...|||:||:|||......::.|.::. .||:.....|||:.||..|||||.:::..|.....
  Fly   125 RKSYKQITFLHIYHHVFMSFGSYALTRYYGTGGHVNAVGLLNSLVHTVMYFYYFLSSEYPGVRAN 189

  Fly   233 LWWKKYMTELQIAQFVLCIFHTLRA-LFSNQCQFSKFISALLLLNASIFFCLFMNFYMQSY-RKT 295
            :|||||:|..|:.||.:.:.:.:.. .||..|...:.:..|.::...:|..||..||:.:| |..
  Fly   190 IWWKKYITLTQLCQFFMLLSYAIYVRFFSPNCGVPRGLLYLNMVQGVVFIYLFGKFYIDNYLRPP 254

  Fly   296 KAAQQLQQ 303
            ||....:|
  Fly   255 KAKINAKQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 83/239 (35%)
CG18609NP_611365.2 ELO 16..257 CDD:279492 85/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449586
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.