DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and CG31141

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_732912.2 Gene:CG31141 / 318605 FlyBaseID:FBgn0051141 Length:253 Species:Drosophila melanogaster


Alignment Length:262 Identity:90/262 - (34%)
Similarity:133/262 - (50%) Gaps:26/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QLVEEDYGDPRAKRFPLMEHPMFTFG-MVAVYLSWVLVI---GPLFMRDRKPFQLRRTLVVYNAF 106
            ::....|.|  :|:.||...|    | ::.:.:.::||:   |..||..|:|:.||:.|..||.|
  Fly     3 EIFRTPYAD--SKQLPLATGP----GPIIIILIGYLLVVFKAGRKFMEHREPYNLRKVLKYYNMF 61

  Fly   107 QV------ALSGYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMF 165
            |:      .|.||.|......     ||.:|..|...|.|.......:.|.||::|:.:..||:|
  Fly    62 QIFYNIMMLLPGYYFMLVFQP-----YNFRCMTVLQQDHPLKNWERCISYAYYINKIVDLLDTVF 121

  Fly   166 FVLRKKSSQITWLHVYHHSVTPLETWVLVKFLA-GGNATFPNLLNNFVHVCMYFYYMMAAMGPEY 229
            .|||||.||||:|||:||.:.|...:::::|.. ||...|....|.|||:.||.||..|..|   
  Fly   122 CVLRKKYSQITFLHVFHHVLMPSAGYLIIRFYGYGGQLFFLCSFNVFVHIFMYAYYYSAIKG--- 183

  Fly   230 AKFLWWKKYMTELQIAQFVLCIFHTLRALFSNQCQFSKFISALLLLNASIFFCLFMNFYMQSYRK 294
             ..:.||:|:|.:|:.||:|...|........||..|:....|:..:|:|.|.:|.|||.|.|.:
  Fly   184 -NTVRWKRYLTLMQMLQFLLMFGHCALTAMQRQCTASQGTLFLVSCSATIMFIMFANFYFQCYLR 247

  Fly   295 TK 296
            .|
  Fly   248 PK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 86/243 (35%)
CG31141NP_732912.2 ELO 34..253 CDD:279492 82/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449589
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.