DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and Elovl4

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001178725.1 Gene:Elovl4 / 315851 RGDID:1305630 Length:314 Species:Rattus norvegicus


Alignment Length:246 Identity:100/246 - (40%)
Similarity:158/246 - (64%) Gaps:2/246 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYNAFQVALSGYMFYEH 118
            |.|.:.:|||:.|..|..:..:||.:|. :||.:|:||:|||:|..|::||...|.|:.::|.|.
  Rat    34 DKRVEDWPLMQSPWPTLSISTLYLLFVW-LGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFREL 97

  Fly   119 LMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKSSQITWLHVYHH 183
            .|..:...|:..||.||||:..:..|:....:.|::||..|:.||:||:||||::|:::||||||
  Rat    98 FMGSYNAGYSYICQSVDYSNDVNEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHH 162

  Fly   184 SVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLWWKKYMTELQIAQFV 248
            .......|:.:|::|||.|.|...:|:|:||.||.||.:.|.||...|:||||:|:|.||:.||.
  Rat   163 CTMFTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLVQFH 227

  Fly   249 LCIFHTLRALFSNQCQFSKFISALLLLNASIFFCLFMNFYMQSYRKTKAAQ 299
            :.|.||..:|::: |.|.|::...|:..|..|..||:|||.::|.:.|.::
  Rat   228 VTIGHTALSLYTD-CPFPKWMHWALIAYAISFIFLFLNFYTRTYNEPKKSK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 97/232 (42%)
Elovl4NP_001178725.1 ELO 41..278 CDD:395916 98/239 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.