DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and Elovl3

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001101072.1 Gene:Elovl3 / 309449 RGDID:1307263 Length:271 Species:Rattus norvegicus


Alignment Length:275 Identity:80/275 - (29%)
Similarity:130/275 - (47%) Gaps:24/275 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TGLVQRYYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVV 102
            |.|:|.|      |:...:..|..|.|:.:.:|.:|.||| .:::.|..:|:.||.|.|:|.|::
  Rat    13 TELIQPY------DFEMSQDLRPFLEEYWVSSFFIVLVYL-LLIIFGQNYMKTRKGFSLQRPLIL 70

  Fly   103 YNAFQVA---LSGYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTM 164
            : :|.:|   :.|.:.....|...|....|| |.|.::|..:...:....:::.|||:.|..||.
  Rat    71 W-SFCLAIFSILGTLRMWKFMGTVLFTMGLK-QTVCFTDYTNDAIVKFWSWVFLLSKVVELGDTA 133

  Fly   165 FFVLRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEY 229
            |.:|||:  .:.::|.||||...|.|....|........|.. :|..||..||.||.|.|...::
  Rat   134 FIILRKR--PLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMT-MNLGVHSVMYTYYTMKAAKVKH 195

  Fly   230 AKFLWWKKYMTELQIAQFVL-CIFHTLRALFSNQ--CQFSK--FISALLLLNASIFFCLFMNFYM 289
            ...|  ...:|.|||.|.|| .||..|..::..:  |..:.  |..:.:|...  :|.||..|:.
  Rat   196 PNIL--PMVITSLQILQMVLGTIFGILNYIWRQERGCYTTSEHFFWSFVLYGT--YFILFAQFFH 256

  Fly   290 QSYRKTKAAQQLQQQ 304
            ::|.:.|...:.:.|
  Rat   257 RAYLRPKRKAESKSQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 72/240 (30%)
Elovl3NP_001101072.1 ELO 30..266 CDD:279492 73/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.