DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and elo-8

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001255110.1 Gene:elo-8 / 259739 WormBaseID:WBGene00001246 Length:292 Species:Caenorhabditis elegans


Alignment Length:300 Identity:60/300 - (20%)
Similarity:109/300 - (36%) Gaps:82/300 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 MFTFGMVAVYLSWVL----VIG-----------PLFMRDRKPFQLRRTLVVYN-AFQVALSGYMF 115
            ||.:..::..::|.|    ::|           |..:.||   ...:....|| .||:.|...|.
 Worm     1 MFPYSWLSSTINWSLLPIHLLGIFYVFVAFNFRPSHISDR---SYLKEWYYYNCVFQLGLGILMI 62

  Fly   116 YEHL---MAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKSSQITW 177
            .|.|   ::||  :|::......|:...|.    ::..::..:|:.:..:|| .:|......:| 
 Worm    63 PEILTSSLSGW--HYSVCHSGTLYTGFFSG----SVVAIWTFTKVVDLLETM-LLLYDARRPLT- 119

  Fly   178 LHVYHHSVT------------PLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYA 230
            :|:.||.::            .|..|::          |.||.   .||.:|.|.       ...
 Worm   120 IHIIHHFLSLSFAFTFYSQNFALHRWIV----------FFNLT---AHVFLYAYL-------SGF 164

  Fly   231 KFL--W---WKKYMTELQIAQFVLCIFHTLRALF----SNQCQFSKFISALLLLNASIFFCLFMN 286
            |.|  |   |....:. |:.|.:|....|..|..    ..:|..:......|.:...:...||..
 Worm   165 KILNRWTPCWVAVCSS-QMLQLILPFIATFSAAAKLARGTRCDANALGLLTLQIGLGVLIILFAE 228

  Fly   287 FY---MQSYRKTK-------AAQQLQQQQQQQKQQQQLDA 316
            ||   :|::||..       .:.....:|:.:|..::|.|
 Worm   229 FYWSRVQAFRKKNMKSGGGGTSNSDSSEQESEKVLKKLKA 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 54/269 (20%)
elo-8NP_001255110.1 ELO 14..243 CDD:295675 53/260 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.