DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and SPAC1B2.03c

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_593930.1 Gene:SPAC1B2.03c / 2542505 PomBaseID:SPAC1B2.03c Length:334 Species:Schizosaccharomyces pombe


Alignment Length:298 Identity:84/298 - (28%)
Similarity:129/298 - (43%) Gaps:81/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PMFTFGMVAVYLS--WVLVI-GPLFMRDRKPFQLRRTLVVYNAFQVALSGYMF-------YEHLM 120
            ||..:..|.|.::  :|::: |...|.:|||.:.||...::|.....:||.:.       :.:.|
pombe    51 PMSQWSSVIVSITAYYVIILSGRAIMTNRKPLKQRRLFQLHNFILTIISGALLALLVEEVFRNYM 115

  Fly   121 AGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKSSQITWLHVYHHSV 185
            ...|.|  ..|....:     ::|::.|.||.||:|..|..||:|..|:||  .:.:||.|||.:
pombe   116 RNGLFY--CVCDSRHF-----TQRLVTLYYLNYLTKYLELMDTVFLFLKKK--PLAFLHCYHHGI 171

  Fly   186 TPL-----------ETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLWWKKYM 239
            |.|           ..|.::.            ||.:|||.||.||.:||.|    :.:|||:::
pombe   172 TALLCFTQLLGRTSVQWGVIG------------LNLYVHVIMYSYYFLAACG----RRVWWKQWV 220

  Fly   240 TELQIAQFV----LCIFHTLRAL---------FSNQCQFSKFISALLLLNASIFFC--------L 283
            |.:||.|||    ||.|.|...:         ....|..|.|        |:.|.|        |
pombe   221 TRVQIIQFVLDLILCYFGTYSHIAFRYFPWLPHVGDCSGSLF--------AAFFGCGVLSSYLFL 277

  Fly   284 FMNFYMQSYRKTKAAQQLQQQQQQQKQQQQLDATPCKA 321
            |:.||:.:|.|..|      ::.|:|...:.|.|...|
pombe   278 FIGFYINTYIKRGA------KKNQRKAAGKADNTSVAA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 77/269 (29%)
SPAC1B2.03cNP_593930.1 ELO 50..294 CDD:279492 79/281 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.