DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and elo-7

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001255397.1 Gene:elo-7 / 186426 WormBaseID:WBGene00001245 Length:309 Species:Caenorhabditis elegans


Alignment Length:272 Identity:87/272 - (31%)
Similarity:129/272 - (47%) Gaps:57/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 EEDYGDPRAKRFPLMEHPMFTFGM-VAVYLSWVLVIGPL--FMRDRKPFQLRRTLVVYNAFQVAL 110
            :|.:...||:|| :.||    ||: |.:.:::|:::..:  |||||:||||...|.::|.|   |
 Worm    50 DEVFPHIRARRF-IQEH----FGLFVQMAIAYVILVFSIKRFMRDREPFQLTTALRLWNFF---L 106

  Fly   111 SGYMFYEHLMAGWLNY------------YNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADT 163
            |.:..|    ..|..:            |...|:.:  |:.||....  ..:|..|||..||.||
 Worm   107 SVFSIY----GSWTMFPFMVQQIRLYGLYGCGCEAL--SNLPSQAEY--WLFLTILSKAVEFVDT 163

  Fly   164 MFFVLRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPN-------LLNNFVHVCMYFYYM 221
            .|.|||||  .:.:||.|||..|      .|.|.:  |...|:       ::|.|||..||.||.
 Worm   164 FFLVLRKK--PLIFLHWYHHMAT------FVFFCS--NYPTPSSQSRVGVIVNLFVHAFMYPYYF 218

  Fly   222 MAAMGPEY-AKFLWWKKYMTELQIAQFVLCIFH-TLR--ALFSNQ--CQFSKFISALLLLNASIF 280
            ..:|..:. ||.   ...:|.||:.||:..|:. ||.  :|.:||  |....|:.......:|.:
 Worm   219 TRSMNIKVPAKI---SMAVTVLQLTQFMCFIYGCTLMYYSLATNQYTCDTPMFVLHSTFALSSSY 280

  Fly   281 FCLFMNFYMQSY 292
            |.||.||:.::|
 Worm   281 FVLFANFFHKAY 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 82/260 (32%)
elo-7NP_001255397.1 ELO 61..299 CDD:279492 83/261 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.