DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and Elovl6

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_599210.1 Gene:Elovl6 / 171402 RGDID:620585 Length:267 Species:Rattus norvegicus


Alignment Length:291 Identity:84/291 - (28%)
Similarity:136/291 - (46%) Gaps:55/291 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NYTGLVQRYYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRR-- 98
            |.:.|..:.|:. |:.:.:..|.:: :.|:...:|...|:|.:::.. |...|..|..|:||:  
  Rat     2 NMSVLTLQEYEF-EKQFNENEAIQW-MQENWKKSFLFSALYAAFIFG-GRHLMNKRAKFELRKPL 63

  Fly    99 -----TLVVYNAFQVALSG-YMFYEHLMAGWLNYYNLKCQPVDYS--DSPSSKRMLNLCYLYYLS 155
                 ||.|::.|....:| ||.|..:..|      ||....|.|  :.|.||..   .|.:.||
  Rat    64 VLWSLTLAVFSIFGALRTGAYMLYILMTKG------LKQSVCDQSFYNGPVSKFW---AYAFVLS 119

  Fly   156 KLTEFADTMFFVLRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYY 220
            |..|..||:|.:|||:  ::.:||.|||....|.:|...|.:..|...|.. :|..||..||.||
  Rat   120 KAPELGDTIFIILRKQ--KLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMT-MNYGVHAVMYSYY 181

  Fly   221 MMAAMG----PEYAKFLWWKKYMTELQIAQFVL-CIFHTLRALF------SNQC--QFSK-FISA 271
            .:.|.|    .::|.|:      |..||.|.:: |:.:.|  :|      ::||  .|.. |.|:
  Rat   182 ALRAAGFRVSRKFAMFI------TLSQITQMLMGCVINYL--VFNWMQHDNDQCYSHFQNIFWSS 238

  Fly   272 LLLLNASIFFCLFMNFYMQSY-----RKTKA 297
            |:.|:..:.||   :|:.::|     :.|||
  Rat   239 LMYLSYLLLFC---HFFFEAYIGKVKKATKA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 76/261 (29%)
Elovl6NP_599210.1 ELO 25..264 CDD:395916 76/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.