DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and Elovl5

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_599209.1 Gene:Elovl5 / 171400 RGDID:620583 Length:299 Species:Rattus norvegicus


Alignment Length:287 Identity:103/287 - (35%)
Similarity:150/287 - (52%) Gaps:38/287 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYNAFQVALSGYMFYEH 118
            |.|.|.:.|:::.:.||...|:|| .::.:||.:|::|:||..|..|||||.....||.|||||.
  Rat    20 DTRVKGWFLLDNYIPTFVCSAIYL-LIVWLGPKYMKNRQPFSCRGILVVYNLGLTLLSLYMFYEL 83

  Fly   119 LMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKSSQITWLHVYHH 183
            :...|...||..||.. .|...|..:::.:.:.||.|||.||.||.||:|||.:.|||.||||||
  Rat    84 VTGVWEGKYNFFCQGT-RSAGESDMKVIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHH 147

  Fly   184 SVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLWWKKYMTELQIAQFV 248
            :......|.::.::..|::.|...||:|:||.||.||.:::: |....:||||||:|:.|:.|||
  Rat   148 ATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSV-PSMRPYLWWKKYITQGQLVQFV 211

  Fly   249 LCIFHTLRALFSNQC---------------QFSKFISALLLLNASIFFCLFMNFYMQSYRKTKAA 298
            |.|..|       .|               |....||.:         .||.|||:|:|.|..|:
  Rat   212 LTIIQT-------SCGVIWPCSFPLGWLYFQIGYMISLI---------ALFTNFYIQTYNKKGAS 260

  Fly   299 QQLQQQQQQQKQQQQLDATPCKADSNN 325
                ::::..|..|....|.....:||
  Rat   261 ----RRKEHLKGHQNGSMTAVNGHTNN 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 93/247 (38%)
Elovl5NP_599209.1 ELO 27..261 CDD:395916 95/256 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.