DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and Elovl6

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_569717.1 Gene:Elovl6 / 170439 MGIID:2156528 Length:267 Species:Mus musculus


Alignment Length:291 Identity:84/291 - (28%)
Similarity:136/291 - (46%) Gaps:55/291 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NYTGLVQRYYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRR-- 98
            |.:.|..:.|:. |:.:.:..|.:: :.|:...:|...|:|.:::.. |...|..|..|:||:  
Mouse     2 NMSVLTLQEYEF-EKQFNENEAIQW-MQENWKKSFLFSALYAAFIFG-GRHLMNKRAKFELRKPL 63

  Fly    99 -----TLVVYNAFQVALSG-YMFYEHLMAGWLNYYNLKCQPVDYS--DSPSSKRMLNLCYLYYLS 155
                 ||.|::.|....:| ||.|..:..|      ||....|.|  :.|.||..   .|.:.||
Mouse    64 VLWSLTLAVFSIFGALRTGAYMLYILMTKG------LKQSVCDQSFYNGPVSKFW---AYAFVLS 119

  Fly   156 KLTEFADTMFFVLRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYY 220
            |..|..||:|.:|||:  ::.:||.|||....|.:|...|.:..|...|.. :|..||..||.||
Mouse   120 KAPELGDTIFIILRKQ--KLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMT-MNYGVHAVMYSYY 181

  Fly   221 MMAAMG----PEYAKFLWWKKYMTELQIAQFVL-CIFHTLRALF------SNQC--QFSK-FISA 271
            .:.|.|    .::|.|:      |..||.|.:: |:.:.|  :|      ::||  .|.. |.|:
Mouse   182 ALRAAGFRVSRKFAMFI------TLSQITQMLMGCVINYL--VFNWMQHDNDQCYSHFQNIFWSS 238

  Fly   272 LLLLNASIFFCLFMNFYMQSY-----RKTKA 297
            |:.|:..:.||   :|:.::|     :.|||
Mouse   239 LMYLSYLVLFC---HFFFEAYIGKVKKATKA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 76/261 (29%)
Elovl6NP_569717.1 ELO 25..264 CDD:395916 76/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.