DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and HOS3-1

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001329164.1 Gene:HOS3-1 / 829836 AraportID:AT4G36830 Length:308 Species:Arabidopsis thaliana


Alignment Length:244 Identity:48/244 - (19%)
Similarity:89/244 - (36%) Gaps:73/244 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WNFLFTDLADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYNFFQVA 76
            |:||||.:     :.:..:.|.|.:|          ||   ...:..:...|.....:::.....
plant    34 WSFLFTSI-----SLYIAVSSSLHIL----------LS---AVRRSNRSVPLGHIPEIHSLLMSI 80

  Fly    77 LSVWMVYEGVVI----------WQYYSWR----CQPVDWSRT-PKAYREARVV----YVYYLAKI 122
            ||. .::.|:::          |   .||    ..|:.|... |...|.:..|    ||:||.:.
plant    81 LSA-TIFAGILLSAAAEIRDTRW---LWRRSKTATPLQWLLCFPLGTRPSGRVFFWSYVFYLTRF 141

  Fly   123 TELLDTIFFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWI-------------N 174
            ..:..|||.|||  .|::....::.::||...|             |: |:             .
plant   142 LHMFRTIFAVLR--SRRLAVSQLFCNSVMAFTS-------------FL-WLEFSQSYQILAILST 190

  Fly   175 SFVHIIMYSYYFLSAFGPQMQKYLWWKKYITNLQMIQFCCAFIHQTQLL 223
            :.|:.::|.|.|.:.||.....:   ..::.|.|::...|..:....:|
plant   191 TLVYSVVYGYRFWTGFGLPGSAF---PSFVVNCQLVLVGCNLVSHAGVL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 43/228 (19%)
HOS3-1NP_001329164.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.