DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and ELOVL7

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001098028.1 Gene:ELOVL7 / 79993 HGNCID:26292 Length:281 Species:Homo sapiens


Alignment Length:279 Identity:133/279 - (47%)
Similarity:174/279 - (62%) Gaps:20/279 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FTDL--------------ADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERT 66
            |:||              ||||..||.|:.||||...:|.||::||.|.|||.|::||||:|::.
Human     3 FSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKA 67

  Fly    67 LLVYNFFQVALSVWMVYEGVVI-WQY-YSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTI 129
            ::.||||.|..||:|.||.|:. |.. ||:||..||:||:|.|.|.||..::||.:|..||||||
Human    68 MITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTI 132

  Fly   130 FFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQM 194
            ||||||.:.|||||||:|||:||...|...|:..||.|||...:|:.||::|||||.|||.||..
Human   133 FFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAY 197

  Fly   195 QKYLWWKKYITNLQMIQFCCAFIHQTQLLY-TDCGY--PRWSVCFTLPNAVFFYFLFNDFYQKSY 256
            |||||||||:|:||::||....||.:|..: .||.|  |.:: |..:..:..|..||..|:.::|
Human   198 QKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFA-CIIMSYSFMFLLLFLHFWYRAY 261

  Fly   257 KKKQAAAKEKALSADNNND 275
            .|.|...|........|.|
Human   262 TKGQRLPKTVKNGTCKNKD 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 117/228 (51%)
ELOVL7NP_001098028.1 ELO 30..269 CDD:307345 121/239 (51%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.