DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and ELOVL6

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001124193.1 Gene:ELOVL6 / 79071 HGNCID:15829 Length:265 Species:Homo sapiens


Alignment Length:256 Identity:69/256 - (26%)
Similarity:108/256 - (42%) Gaps:64/256 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AFYLFFVLSWGPKFMKDRKPFKLERTLLVYNFFQVALSV--------WMVY--------EGVVIW 89
            |.|..|:.. |...|..|..|:|.:.|::::......|:        :|||        :.|...
Human    38 ALYAAFIFG-GRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQ 101

  Fly    90 QYYSWRCQPVD--WSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKNDRQVTFLHVYHHTVMP 152
            .:|:   .||.  |:            |.:.|:|..||.||||.:|||  :::.|||.|||..:.
Human   102 GFYN---GPVSKFWA------------YAFVLSKAPELGDTIFIILRK--QKLIFLHWYHHITVL 149

  Fly   153 MISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWKKYITNLQMIQ------ 211
            :.||.:.|....|.|.|: .:|..||.:|||||.|.|.|.::.:.  :..:||..|:.|      
Human   150 LYSWYSYKDMVAGGGWFM-TMNYGVHAVMYSYYALRAAGFRVSRK--FAMFITLSQITQMLMGCV 211

  Fly   212 -----FC------CAFIHQTQLLYTDCGYPRWSVCFTLPNAVFFYFLFNDFYQKSYKKKQA 261
                 ||      | ..|...:.::...|..:.|       :|.:|.|..:..|..|..:|
Human   212 VNYLVFCWMQHDQC-HSHFQNIFWSSLMYLSYLV-------LFCHFFFEAYIGKMRKTTKA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 66/245 (27%)
ELOVL6NP_001124193.1 ELO 25..260 CDD:395916 67/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.