DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and Elovl7

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_083277.3 Gene:Elovl7 / 74559 MGIID:1921809 Length:281 Species:Mus musculus


Alignment Length:277 Identity:125/277 - (45%)
Similarity:171/277 - (61%) Gaps:22/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FTDL--------------ADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERT 66
            |:||              ||||..|:.|:.||||...||..|::||.|.|||.|::||||:|::.
Mouse     3 FSDLTSRTVRFYDNWIKDADPRVEDYLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKA 67

  Fly    67 LLVYNFFQVALSVWMVYEGVVI-W-QYYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTI 129
            ::.||||.|..||:|.||.|:. | ..||:||..||:|::|:|.|.....::||.:|..||||||
Mouse    68 MITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELLDTI 132

  Fly   130 FFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQM 194
            ||||||.:.|||||||:|||:||...|...|:..||.|||..::|:.||::|||||.|.|.||..
Mouse   133 FFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFLNTAVHVVMYSYYGLCAMGPAY 197

  Fly   195 QKYLWWKKYITNLQMIQFCCAFIHQTQLLY-TDCGYPRWSVCFTLPN-AVFFYFLFNDFYQKSYK 257
            ||||||||::|:||::||....||..|:.: .||.|......:.:.: ...|..||..|:.::|.
Mouse   198 QKYLWWKKHLTSLQLVQFVLVTIHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYT 262

  Fly   258 KKQAAAKEKALSADNNN 274
            |.|...|    :.:|.|
Mouse   263 KGQRLPK----TLENGN 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 110/227 (48%)
Elovl7NP_083277.3 ELO 30..269 CDD:279492 114/238 (48%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.