DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and Elovl1

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001037740.1 Gene:Elovl1 / 679532 RGDID:1587151 Length:279 Species:Rattus norvegicus


Alignment Length:252 Identity:116/252 - (46%)
Similarity:165/252 - (65%) Gaps:9/252 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LFTDL---ADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYNFFQVA 76
            |:.:|   ||||..::.|:.|||.:..||..|::||||.||:.|.:||||:|...::||||..|.
  Rat     7 LYQELMKCADPRIQNYPLMGSPLLITSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVT 71

  Fly    77 LSVWMVYEGVVI-W-QYYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKNDRQ 139
            ||:::|||.::. | ..|:|||.|||:|..|:|.|..||.:::.|:|:.||:||:.|:|||.|.|
  Rat    72 LSLYIVYEFLMSGWLSTYTWRCDPVDFSNNPEALRMVRVAWLFMLSKVIELMDTVIFILRKKDGQ 136

  Fly   140 VTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWKKYI 204
            ||||||:||:|:|...|...|..|||.|:|...|||.||::||.||.|||.||..|.||||||::
  Rat   137 VTFLHVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHM 201

  Fly   205 TNLQMIQFCCAFIHQTQLLY-TDCGYPRWSVCFTL--PNAVFFYFLFNDFYQKSYKK 258
            |.:|:|||....:|.:|..: ..|.| ::.:...|  .....|:.||::|:..||.|
  Rat   202 TAIQLIQFVLVSLHISQYYFMPSCNY-QYPIIIHLIWMYGTIFFILFSNFWYHSYTK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 106/228 (46%)
Elovl1NP_001037740.1 ELO 23..260 CDD:395916 110/236 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.