DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and ELOVL1

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001243328.1 Gene:ELOVL1 / 64834 HGNCID:14418 Length:279 Species:Homo sapiens


Alignment Length:265 Identity:123/265 - (46%)
Similarity:170/265 - (64%) Gaps:9/265 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYNFFQVALSVWMVYE 84
            ||||...:.|:.|||.:..||..|::||||.||:.|.:||||:|...::||||..||||:::|||
Human    15 ADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVALSLYIVYE 79

  Fly    85 GVVI-W-QYYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKNDRQVTFLHVYH 147
            .::. | ..|:|||.|||:|.:|:|.|..||.:::..:|..||:||:.|:|||.|.|||||||:|
Human    80 FLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFLHVFH 144

  Fly   148 HTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWKKYITNLQMIQF 212
            |:|:|...|...|..|||.|:|...|||.||:|||.||.||||||..|.||||||::|.:|:|||
Human   145 HSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQF 209

  Fly   213 CCAFIHQTQLLY-TDCGYPRWSVCFTL--PNAVFFYFLFNDFYQKSYKKKQAAAKEKALSADNNN 274
            ....:|.:|..: :.|.| ::.|...|  .....|:.||::|:..||.|.:..  .:||. .|..
Human   210 VLVSLHISQYYFMSSCNY-QYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRL--PRALQ-QNGA 270

  Fly   275 DGCAK 279
            .|.||
Human   271 PGIAK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 109/228 (48%)
ELOVL1NP_001243328.1 ELO 23..260 CDD:307345 113/237 (48%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.