DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and ELOVL5

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001229757.1 Gene:ELOVL5 / 60481 HGNCID:21308 Length:326 Species:Homo sapiens


Alignment Length:290 Identity:100/290 - (34%)
Similarity:147/290 - (50%) Gaps:39/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DPRTNDWFLIKSPLPLLGILAFYLFFVLSW-GPKFMKDRKPFKLERTLLVYNFFQVALSVWMVYE 84
            |.|...|||:.:.:|.......||..|  | |||:|::::||.....|:|||.....||::|..|
Human    20 DTRVKGWFLLDNYIPTFICSVIYLLIV--WLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCE 82

  Fly    85 G----------------------------VVIWQ-YYSWRCQPVDWSRT--PKAYREARVVYVYY 118
            .                            ..:|: .|::.||   .:||  ....:..||::.||
Human    83 SKREQPRRSACASRTDPSTQQQLPENRLVTGVWEGKYNFFCQ---GTRTAGESDMKIIRVLWWYY 144

  Fly   119 LAKITELLDTIFFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYS 183
            .:|:.|.:||.||:||||:.|:|.||||||..|..|.|....:.|.||..|...:|||:|::|||
Human   145 FSKLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYS 209

  Fly   184 YYFLSAFGPQMQKYLWWKKYITNLQMIQFCCAFIHQTQLLYTDCGYPRWSVCFTLPNAVFFYFLF 248
            ||.||:. |.|:.|||||||||..|::||....|..:..:...|.:|...:.|.:...:....||
Human   210 YYGLSSV-PSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALF 273

  Fly   249 NDFYQKSYKKKQAAAKEKALSADNNNDGCA 278
            .:||.::|.||.|:.::..|. |:.|...|
Human   274 TNFYIQTYNKKGASRRKDHLK-DHQNGSMA 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 87/255 (34%)
ELOVL5NP_001229757.1 ELO 27..288 CDD:366492 93/266 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.