DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and Elovl2

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_062296.1 Gene:Elovl2 / 54326 MGIID:1858960 Length:292 Species:Mus musculus


Alignment Length:262 Identity:105/262 - (40%)
Similarity:142/262 - (54%) Gaps:10/262 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DPRTNDWFLIKSPLPLLGILAFYLFFVLSW-GPKFMKDRKPFKLERTLLVYNFFQVALSVWMVYE 84
            |.|...|||:.|.||...:...||..:  | |.|:||:|....|...|.:||.....||.:|:.|
Mouse    23 DSRVRGWFLLDSYLPTFILTITYLLSI--WLGNKYMKNRPALSLRGILTLYNLAITLLSAYMLVE 85

  Fly    85 GVV-IWQ-YYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKNDRQVTFLHVYH 147
            .:: .|: .|:.:||.:| |......|.|:|::.||.:|:.|.||||||||||...|:|||||||
Mouse    86 LILSSWEGGYNLQCQNLD-SAGEGDVRVAKVLWWYYFSKLVEFLDTIFFVLRKKTNQITFLHVYH 149

  Fly   148 HTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWKKYITNLQMIQF 212
            |..|..|.|....:.|.|...|...:|||:||:|||||.||.| |.|.||||||||:|..|::||
Mouse   150 HASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVF-PSMHKYLWWKKYLTQAQLVQF 213

  Fly   213 CCAFIHQTQLLYTDCGYPRWSVCFTLPNAVFFYFLFNDFYQKSYKKKQAAAKEKALSADNNNDGC 277
            .....|....:...||:|...:.|.....:....||.:||.::|:||..   :|.|......:|.
Mouse   214 VLTITHTLSAVVKPCGFPFGCLIFQSSYMMTLVILFLNFYIQTYRKKPV---KKELQEKEVKNGF 275

  Fly   278 AK 279
            .|
Mouse   276 PK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 93/226 (41%)
Elovl2NP_062296.1 ELO 30..264 CDD:307345 98/240 (41%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03202 289..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.