DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and Elovl2

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_038951934.1 Gene:Elovl2 / 498728 RGDID:1308605 Length:296 Species:Rattus norvegicus


Alignment Length:256 Identity:105/256 - (41%)
Similarity:140/256 - (54%) Gaps:15/256 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DPRTNDWFLIKSPLPLLGILAFYLFFVLSW-GPKFMKDRKPFKLERTLLVYNFFQVALSVWMVYE 84
            |.|...|||:.|.||...:...||..:  | |.|:||:|....|...|.:||.....||.:|:.|
  Rat    23 DSRVRGWFLLDSYLPTFTLTIVYLLSI--WLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLVE 85

  Fly    85 GVV-IWQ-YYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKNDRQVTFLHVYH 147
            .|: .|: .|:.:||.:| |......|.|:|::.||.:|:.|.||||||||||...|:|||||||
  Rat    86 LVLSSWEGGYNLQCQNLD-SAGEGDIRVAKVLWWYYFSKLVEFLDTIFFVLRKKTSQITFLHVYH 149

  Fly   148 HTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWKKYITNLQMIQF 212
            |..|..|.|....:.|.|...|...:|||:||:|||||.||.| |.|.:|||||||:|..|::||
  Rat   150 HASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVF-PSMHRYLWWKKYLTQAQLVQF 213

  Fly   213 CCAFIHQTQLLYTDCGYPRWSVCFTLPNAVFFYFLFNDFYQKSYKKKQ--------AAAKE 265
            .....|....:...||:|...:.|.....:....||.:||.::|:||.        ||.||
  Rat   214 VLTITHTLSAVVKPCGFPFGCLIFQSSYMMTLVILFLNFYIQTYRKKPMKKEMPEGAAGKE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 93/226 (41%)
Elovl2XP_038951934.1 ELO 30..264 CDD:395916 98/237 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.