DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and Baldspot

DIOPT Version :10

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_001237830.3 Gene:Baldspot / 4576681 VectorBaseID:AGAMI1_012789 Length:315 Species:Anopheles gambiae


Alignment Length:139 Identity:29/139 - (20%)
Similarity:49/139 - (35%) Gaps:33/139 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 LPWRALFHGVPYARTARILIAMSIPGQVLFIFVADYIHMSRSTIGAPFVLSYLFVSTLQIMLLLY 606
            :.|.....|..:....::|...::|......|  |.:|:....|   |.:.||..|...:...|.
Mosquito   164 IKWLCFHSGYDFGYLLKLLTDQNLPPDESEFF--DLLHIYFPNI---FDIKYLMKSCKNLKGGLQ 223

  Fly   607 IAHIIIHLMWKWKIDPDNSAIPYLTALGDLFGSSFLM--LAFLFLRSI------------GHPYG 657
            .....:.|.   ::.|.:.|           ||..|:  :||..:|.:            ||.||
Mosquito   224 EVADQLELR---RVGPQHQA-----------GSDALLTGMAFFKMREMFFEDNIDHAKYSGHLYG 274

  Fly   658 EKSSETVDG 666
            ..:|..|:|
Mosquito   275 LGTSFIVNG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:460083
BaldspotXP_001237830.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.