DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and elovl1a

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001005989.1 Gene:elovl1a / 449816 ZFINID:ZDB-GENE-041010-66 Length:315 Species:Danio rerio


Alignment Length:260 Identity:111/260 - (42%)
Similarity:161/260 - (61%) Gaps:13/260 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYNFFQVALSVWMVYEG 85
            |.|..|:.|::||:.:..||..|:|.||..||::|..||||:|...::.||||.||.:.:.|||.
Zfish    21 DARVRDYPLMQSPILMTFILLGYVFSVLYVGPRYMASRKPFRLNTAMIAYNFFMVAFNAYTVYEF 85

  Fly    86 VVI-W-QYYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKNDRQVTFLHVYHH 148
            ::. | ..|:|||...|.|.:|:|.|..|..:::|.:|..|||||:||||||...||||||::||
Zfish    86 LMSGWATTYTWRCDLCDPSSSPQALRMVRAAWLFYFSKYIELLDTVFFVLRKKHSQVTFLHIFHH 150

  Fly   149 TVMPMI-SWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWKKYITNLQMIQF 212
            :|:|.. .||.:....||.|:|...:|:.||:|||:||.|:|.||:.|||||||||:|.:|:|||
Zfish   151 SVLPWTWWWGITLTPAGGMGSFHALVNACVHVIMYTYYGLAAAGPRFQKYLWWKKYMTAIQLIQF 215

  Fly   213 CCAFIHQTQLLYTD-CGY--PRWSVCFTLPNAVFFYFLFNDFYQKSYKKKQAAAKEKALSADNNN 274
            .....|.:|..:.: |.|  |.: :...|....||:.||::|:.::|      .|.|.|...|.:
Zfish   216 VLVTGHISQYYFMEKCDYQVPIF-IHLILIYGTFFFILFSNFWIQAY------IKGKRLPVSNED 273

  Fly   275  274
            Zfish   274  273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 102/229 (45%)
elovl1aNP_001005989.1 ELO 28..266 CDD:279492 105/244 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.