DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and elovl7

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001005456.1 Gene:elovl7 / 448054 XenbaseID:XB-GENE-942805 Length:299 Species:Xenopus tropicalis


Alignment Length:281 Identity:120/281 - (42%)
Similarity:165/281 - (58%) Gaps:20/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYNFFQVALSVWMVYE 84
            ||||..||.|:.:|:|...|:..|::||.|.||:.|::||||.|:..:..||.|.|..|::|.||
 Frog    21 ADPRVEDWPLMSTPIPQTIIIGAYIYFVTSLGPRIMENRKPFALKEIMACYNLFMVLFSLYMCYE 85

  Fly    85 GVVI-WQY-YSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKNDRQVTFLHVYH 147
            .::. |.. ||:||..||:|::|:|.|.|...:::|.:|..|||||:||||||.:.|:|||||||
 Frog    86 FLMSGWAAGYSYRCDIVDYSQSPQALRMAWTCWLFYFSKFIELLDTVFFVLRKKNSQITFLHVYH 150

  Fly   148 HTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWKKYITNLQMIQF 212
            |::||...|...|:..||.|||...:|..||:||||||.|||.||..|||||||||:|::|:.||
 Frog   151 HSIMPWTWWFGVKFAAGGLGTFHALVNCVVHVIMYSYYGLSALGPAYQKYLWWKKYMTSIQLTQF 215

  Fly   213 CCAFIHQTQLLYTD-CGYPR-------WSVCFTLPNAVFFYFLFNDFYQKSYKKKQAAAK--EKA 267
            .....|..|..:.: |.|..       |...|.      |..||.:|:..:|.|.|...|  :..
 Frog   216 LMVTFHIGQFFFMENCPYQYPIFLYVIWLYGFV------FLLLFLNFWFHAYTKGQRLPKNLQNG 274

  Fly   268 LSADNN--NDGCAKDLNKAIQ 286
            ...:||  |..|....|.|::
 Frog   275 HCKNNNQENAQCKNQRNGALK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 103/233 (44%)
elovl7NP_001005456.1 ELO 29..228 CDD:395916 96/198 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.