DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and zgc:92749

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001002570.1 Gene:zgc:92749 / 436843 ZFINID:ZDB-GENE-040718-309 Length:266 Species:Danio rerio


Alignment Length:265 Identity:73/265 - (27%)
Similarity:116/265 - (43%) Gaps:60/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYNFFQVALSV-------WMVY---------E 84
            |.|..|..:|.    |..|||||:...|...|::::......|:       |.::         :
Zfish    33 LSGTYAVLIFL----GHMFMKDRQKLDLRAPLVLWSMSLAVFSIVGTLRTGWYMFNVVCSEGFRQ 93

  Fly    85 GVVIWQYYSWRCQPVD--WSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKNDRQVTFLHVYH 147
            .|....:||   .||.  |:            :.:.::|..||.||:|.||||  :::.|||.||
Zfish    94 SVCDTDFYS---APVSKFWA------------FAFAISKAPELGDTVFVVLRK--QRLIFLHWYH 141

  Fly   148 HTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWKKYITNLQMIQF 212
            |..:.:.||.:.|.:..|.|.|:. :|..||..|||||...|.|.::.:.  :...||.||:.|.
Zfish   142 HITVLLYSWFSYKDHVAGGGWFMS-MNFTVHAFMYSYYTAKAAGVRVPRA--FAMLITVLQISQM 203

  Fly   213 CCAFIHQTQLLYTDCGYPRW---SVCFTLPNAVFF----YF----LFNDFYQKSYKKKQAAAKEK 266
             .|.:....|:|:      |   ..|.:..|.:.|    ||    ||..|:.:||.::....:::
Zfish   204 -AAGLTVLGLVYS------WKHEQHCKSTDNNIIFGSAMYFSYLPLFCAFFYQSYIRRSDGGQKR 261

  Fly   267 ALSAD 271
            .|..|
Zfish   262 RLKRD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 68/244 (28%)
zgc:92749NP_001002570.1 ELO 22..255 CDD:279492 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.