DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and CG33110

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster


Alignment Length:286 Identity:124/286 - (43%)
Similarity:181/286 - (63%) Gaps:23/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YWNFLFTDLADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYNFFQV 75
            |:..:..|..|||...:.|::.|:...|::|.||.:||..||.||:|||||:|.|||:|||.|||
  Fly    44 YYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYNAFQV 108

  Fly    76 ALSVWMVYEGVVI-W-QYYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKNDR 138
            |||.:|.||.::. | .||:.:|||||:|.:|.:.|...:.|:|||:|:||..||:||||||...
  Fly   109 ALSGYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKSS 173

  Fly   139 QVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWKKY 203
            |:|:||||||:|.|:.:|...|:..||:.||...:|:|||:.||.||.::|.||:..|:||||||
  Fly   174 QITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLWWKKY 238

  Fly   204 ITNLQMIQFCCAFIHQTQLLYTD-CGYPRWSVCFTLPNAVFFYFLFNDFYQKSYKKKQAAAKEKA 267
            :|.||:.||.....|..:.|::: |.:.::.....|.||..|:.||.:||.:||:|.:||     
  Fly   239 MTELQIAQFVLCIFHTLRALFSNQCQFSKFISALLLLNASIFFCLFMNFYMQSYRKTKAA----- 298

  Fly   268 LSADNNNDGCAKDLNKAIQLQQEKQK 293
                           :.:|.||::||
  Fly   299 ---------------QQLQQQQQQQK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 107/226 (47%)
CG33110NP_788716.1 ELO 61..294 CDD:279492 111/232 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449578
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28030
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1110.910

Return to query results.
Submit another query.