DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and bond

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster


Alignment Length:291 Identity:120/291 - (41%)
Similarity:169/291 - (58%) Gaps:26/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYNFFQVALSVWM---- 81
            |...:.|||:.||:|::.::..||.|||..||::||:|||..|:|.::.||.|||..|:||    
  Fly    20 DETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWMCRTS 84

  Fly    82 VYEGVVIWQYYSWRCQPVDWSRTPKAYREARV-----VYVYYLAKITELLDTIFFVLRKNDRQVT 141
            :.|..|:...:|.:|   :.:||    ||..:     .:.|:.:||.:||||.||||||.|.||:
  Fly    85 IQESNVMASIFSKKC---EINRT----REQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVS 142

  Fly   142 FLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWKKYITN 206
            ||||||||:..:.|||..||.||..|..||.:||.||||||.||.::|.|||.|||||||||:|:
  Fly   143 FLHVYHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTS 207

  Fly   207 LQMIQFCCAFIHQTQLLYTDCGYPRWSVCFTLPNAVFFYFLFNDFYQKSYKKKQ----------A 261
            :|:|||.....:...:....|..|:....|.:.|.|.|.:||.:||:|:|||.:          :
  Fly   208 IQLIQFVLILGYMLTVGAKGCNMPKTLTFFFVGNTVIFLYLFGNFYRKTYKKAKSVDGGSRTTGS 272

  Fly   262 AAKEKALSADNNNDGCAKDLNKAIQLQQEKQ 292
            :..:.||.|........:.:|....|.|..|
  Fly   273 SLAQSALRAAGGMGCMPQTMNAGKHLLQNGQ 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 105/232 (45%)
bondNP_651062.3 ELO 27..262 CDD:279492 111/241 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449593
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28030
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1110.910

Return to query results.
Submit another query.