DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and CG9458

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster


Alignment Length:275 Identity:109/275 - (39%)
Similarity:144/275 - (52%) Gaps:49/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DLADPRTNDWFLIKSP-----LPLLG-------ILAFYLFFVLSWGPKFMKDRKPFKLERTLLVY 70
            ||.|      ||.|||     ||||.       :||.|||||...|||.|::||||.|...:..|
  Fly     4 DLVD------FLGKSPPDPVRLPLLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAY 62

  Fly    71 NFFQVALSVWMVYEGVVIW---QYYSWRC---QPVD-----WSRTPKAYREARVVYVYYLAKITE 124
            |..|:..:|.|.:..|...   ..|:::|   .|.|     |.|.        :.|.|:..|:.:
  Fly    63 NIMQIVYNVIMCFFAVHFMLGPGDYNFKCIKNLPPDHEYKTWERW--------LTYSYFFNKLLD 119

  Fly   125 LLDTIFFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYP-GGHGTFIGWINSFVHIIMYSYYFLS 188
            ||:|:||||||.|||::||||:||..|...|:....||. ||||.|:.:.|..|||:|||||:.|
  Fly   120 LLETVFFVLRKKDRQISFLHVFHHMYMLYFSFMYLYYYGYGGHGFFMCFFNVVVHIMMYSYYYQS 184

  Fly   189 AFGPQMQKYLWWKKYITNLQMIQFCCAFIHQTQLLYT----DCGYPRWSVCFTLPNAVFFYFLFN 249
            :.....:..||||||||.:|:|||.....|.   :||    ||...|:|.......:|.|..||:
  Fly   185 SLNRDSKGDLWWKKYITIVQLIQFGIVLGHS---IYTLKQPDCPSARFSATCAGSISVVFIILFS 246

  Fly   250 DFYQKSY----KKKQ 260
            :||..:|    |:||
  Fly   247 NFYFHAYIRPKKRKQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 100/251 (40%)
CG9458NP_731419.1 ELO 20..261 CDD:279492 98/251 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449595
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.