DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and CG8534

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster


Alignment Length:264 Identity:96/264 - (36%)
Similarity:136/264 - (51%) Gaps:48/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYNFFQVALSVWMVYEGVV------ 87
            ||.||.|.|.|::.||.|||..|.|||::|||:.|.|.:..||..|:      ||.||:      
  Fly    20 LIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQI------VYNGVILIAGLH 78

  Fly    88 ---IWQYYSWRC---QPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKNDRQVTFLHVY 146
               :.:.|..||   .|:|.....   ||..:.|.|:..|..:||:|:||||||.|||::||||:
  Fly    79 FLFVLKAYDLRCITKLPLDHELKS---RERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVF 140

  Fly   147 HHTVMPMISWGTSKYYPGG--HGTFIGW---------INSFVHIIMYSYYFLSAFGPQMQKYLWW 200
            ||.||..          ||  |.||.|:         :|..||:|||:||:||:....:|... |
  Fly   141 HHLVMSF----------GGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-W 194

  Fly   201 KKYITNLQMIQFCCAFIH-QTQLLYTDCGYPRWSVCFTLPNAVFFYFLFNDFYQKSY----KKKQ 260
            |||||.:|::||.....: ...|:..||...|..:...:..:..|..:|.:||..:|    .|::
  Fly   195 KKYITIVQLVQFILVLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYILNGSKQK 259

  Fly   261 AAAK 264
            :|.|
  Fly   260 SALK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 90/246 (37%)
CG8534NP_649955.1 ELO 19..259 CDD:366492 94/258 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449591
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.