DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and elovl5

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_956747.1 Gene:elovl5 / 393425 ZFINID:ZDB-GENE-040407-2 Length:291 Species:Danio rerio


Alignment Length:289 Identity:104/289 - (35%)
Similarity:153/289 - (52%) Gaps:13/289 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VDYWNFLFTDLADPRTNDWFLIKSPLPLLGILAFYLFFVLSW-GPKFMKDRKPFKLERTLLVYNF 72
            :|.|    ....|.|...|||:...:|.......||..|  | |||:||:|:.:.....|:.||.
Zfish    12 IDSW----MGPRDLRVTGWFLLDDYIPTFIFTVMYLLIV--WMGPKYMKNRQAYSCRALLVPYNL 70

  Fly    73 FQVALSVWMVYEGVV-IWQ-YYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLRK 135
            ....||::|.||.|: ::| .|::.||... |......|...|::.||.:|:.|.:||.||:|||
Zfish    71 CLTLLSLYMFYELVMSVYQGGYNFFCQNTH-SGGDADNRMMNVLWWYYFSKLIEFMDTFFFILRK 134

  Fly   136 NDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWW 200
            |:.|:||||||||..|..|.|....:.|.||..|....|||:|::|||||.|||. |.::.||||
Zfish   135 NNHQITFLHVYHHATMLNIWWFVMNWVPCGHSYFGATFNSFIHVLMYSYYGLSAV-PALRPYLWW 198

  Fly   201 KKYITNLQMIQFCCAFIHQTQLLYTDCGYPRWSVCFTLPNAVFFYFLFNDFYQKSYKKKQAAAKE 265
            |||||..|::||.......:..:...||:|...:.|.:...|....||::||.::|||:..:.|.
Zfish   199 KKYITQGQLVQFVLTMFQTSCAVVWPCGFPMGWLYFQISYMVTLILLFSNFYIQTYKKRSGSRKS 263

  Fly   266 KALSADNNNDGCAKDLNKAIQLQQEKQKA 294
            ...:...|  |....:..:.:::..|.:|
Zfish   264 DYPNGSVN--GHTNGVMSSEKIKHRKARA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 89/226 (39%)
elovl5NP_956747.1 ELO 27..262 CDD:279492 94/238 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.