DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and Elo68beta

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster


Alignment Length:264 Identity:101/264 - (38%)
Similarity:150/264 - (56%) Gaps:3/264 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NATQVDYWNFLFTDLADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLV 69
            |.|:.:.:::.|.||||.||.||.|:|||..::.:||.||..| .:.||:....||.:|...|..
  Fly     7 NDTKTESYSYPFADLADERTQDWPLVKSPWNIIALLALYLLMV-RYAPKWTARCKPLQLRVPLFC 70

  Fly    70 YNFFQVALSVWMVYEGVV--IWQYYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFV 132
            ::...:.|:.::..|.:.  :...|::.||....|..|...|.|..::.:|::||.|.:||.||:
  Fly    71 HSLAMIFLNGYICLEFLTASLSLGYNFACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTAFFI 135

  Fly   133 LRKNDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKY 197
            ||....|::|||||||:.|.:..|...|:.|.|...|...||||||:||||||.||..||::|::
  Fly   136 LRHKWNQLSFLHVYHHSTMFLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRVQRF 200

  Fly   198 LWWKKYITNLQMIQFCCAFIHQTQLLYTDCGYPRWSVCFTLPNAVFFYFLFNDFYQKSYKKKQAA 262
            ||||:|:|.||::||...|...:||::..|.|.:|.........|.|.|:|..||.:.|......
  Fly   201 LWWKRYLTGLQLVQFTIIFFWASQLVFRGCEYGKWLTPIGAAYMVPFLFMFGRFYAQKYCVSAVV 265

  Fly   263 AKEK 266
            .|.|
  Fly   266 KKAK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 85/225 (38%)
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 80/219 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473106
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.