DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and CG17821

DIOPT Version :10

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster


Alignment Length:243 Identity:51/243 - (20%)
Similarity:82/243 - (33%) Gaps:80/243 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 VLDFVLVAVILISSRTTMNP------------DNLATPLAASIGDVVSISLLAAMATLLFEHI-- 432
            :.|::|:....|.::..:.|            |:|.       |..:|:..|        |.|  
  Fly    66 IKDYLLMEEEFIRNQERLKPQEEKIEEERSKVDDLR-------GSPMSVGTL--------EEIID 115

  Fly   433 DTHLWV-TFVMVAVYVFLLPF----------WMLLVYRNKYTRSVLSTGWVPVLSALFISGMGGL 486
            |.|..| |.|....||.:|.|          .:||.::......||.....|:::.        :
  Fly   116 DNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLGDDTDPMVTV--------M 172

  Fly   487 VLDKAVGIFNGFVVFQPIINGIGGNLVSVQASKISTML---HQS--SIIGIIPPHAKIFELPWRA 546
            .|:||.         |.....|||....:|..|.|..|   |..  ..:||.||..        .
  Fly   173 KLEKAP---------QETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKG--------V 220

  Fly   547 LFHGVPYARTARILIAMSIPGQVLFIFVADYIHMSRSTIGAPFVLSYL 594
            :.:|.|  .|.:.|:|.::..|....|:        ..:|:..:..||
  Fly   221 ILYGPP--GTGKTLLAKAVANQTSATFL--------RVVGSELIQKYL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:460083
CG17821NP_725820.2 ELO 20..262 CDD:460083 51/243 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.