DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and CG18609

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster


Alignment Length:256 Identity:102/256 - (39%)
Similarity:143/256 - (55%) Gaps:22/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYNFFQVALSVWMVYE 84
            |||  |...|..||.|:..||..||.|||..|..||::|||:.|:..|.|||.|||..:  .:|.
  Fly    10 ADP--NPIPLAGSPWPITLILIAYLLFVLKLGKIFMRNRKPYDLKTVLKVYNLFQVLYN--GLYF 70

  Fly    85 GVVIWQYYSW---RCQPVDWSRTPKAYRE---ARVVY-VYYLAKITELLDTIFFVLRKNDRQVTF 142
            |:|.  ||.:   .|........|:.:..   .||:: .|.|.|:.:|:||:||||||:.:|:||
  Fly    71 GMVF--YYLFIVGICNLHCIESFPEGHERKQLERVLHAAYLLNKVLDLMDTVFFVLRKSYKQITF 133

  Fly   143 LHVYHHTVMPMISWGTSKYY-PGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWKKYITN 206
            ||:|||..|...|:..::|| .|||...:|.:||.||.:||.|||||:..|.::..:|||||||.
  Fly   134 LHIYHHVFMSFGSYALTRYYGTGGHVNAVGLLNSLVHTVMYFYYFLSSEYPGVRANIWWKKYITL 198

  Fly   207 LQMIQFCCAFIHQTQLLYT-----DCGYPRWSVCFTLPNAVFFYFLFNDFYQKSYKKKQAA 262
            .|:.||   |:..:..:|.     :||.||..:...:...|.|.:||..||..:|.:...|
  Fly   199 TQLCQF---FMLLSYAIYVRFFSPNCGVPRGLLYLNMVQGVVFIYLFGKFYIDNYLRPPKA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 94/236 (40%)
CG18609NP_611365.2 ELO 16..257 CDD:279492 98/248 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449597
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.