DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and elovl4b

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_956266.1 Gene:elovl4b / 335732 ZFINID:ZDB-GENE-030131-7672 Length:303 Species:Danio rerio


Alignment Length:296 Identity:121/296 - (40%)
Similarity:175/296 - (59%) Gaps:22/296 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VDYWNFLFTDLADPRTNDWFLIKSPLPLLGILAFYLFFVLSW-GPKFMKDRKPFKLERTLLVYNF 72
            |:::.:..| :||.|...|.::.||||.|||...||.|:  | ||.:|::|:||:|.:||:||||
Zfish    12 VEFYKWSLT-IADKRVEKWPMMSSPLPTLGISVLYLLFL--WAGPLYMQNREPFQLRKTLIVYNF 73

  Fly    73 FQVALSVWMVYE--------GVVIWQYYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTI 129
            ..|.|:.::..|        |      ||:.||||::|......|.|..::.||::|..|.|||:
Zfish    74 SMVLLNFYICKELLLGSRAAG------YSYLCQPVNYSNDVNEVRIASALWWYYISKGVEFLDTV 132

  Fly   130 FFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQM 194
            ||::||...||:|||||||..|.::.|...|:.|||...|...|||.:|::||.||.|:||||::
Zfish   133 FFIMRKKFNQVSFLHVYHHCTMFILWWIGIKWVPGGQSFFGATINSGIHVLMYGYYGLAAFGPKI 197

  Fly   195 QKYLWWKKYITNLQMIQFCCAFIHQTQLLYTDCGYPRWSVCFTLPNAVFFYFLFNDFYQKSYKKK 259
            |||||||||:|.:|||||.....|....|||.|.:|.|.....:..||.|..||.:||.::|:::
Zfish   198 QKYLWWKKYLTIIQMIQFHVTIGHAAHSLYTGCPFPAWMQWALIGYAVTFIILFANFYYQTYRRQ 262

  Fly   260 QAAAKEKALSADNNNDGCAKDLNKAIQLQQ--EKQK 293
            ...  :.|.||.|.........:|..::.:  :|||
Zfish   263 PRL--KTAKSAVNGVSMSTNGTSKTAEVTENGKKQK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 104/232 (45%)
elovl4bNP_956266.1 ELO 30..266 CDD:279492 107/245 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41488
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.