DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and CG31523

DIOPT Version :10

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_649474.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster


Alignment Length:96 Identity:26/96 - (27%)
Similarity:39/96 - (40%) Gaps:27/96 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 WMLLVYRNKYTRSVLSTGWVPVLSALFISGMGGLVLDKAVGIFN-------GFVVFQPIINGIGG 510
            |  |..|.||...|.| |::...|       |||..||...::.       ||.|.:.||..   
  Fly   700 W--LQNRMKYPVFVTS-GYLDEQS-------GGLKKDKVHKVYGCASIKTFGFNVSKQIIRD--- 751

  Fly   511 NLVSVQASKISTMLHQSSIIGIIPPHAKIFE 541
               ::.:.:::||..|    |.:.|...|:|
  Fly   752 ---ALLSKQMATMYLQ----GKLTPMNYIYE 775

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:460083
CG31523NP_649474.1 ELO 28..264 CDD:460083
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.