DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and CG31141

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_732912.2 Gene:CG31141 / 318605 FlyBaseID:FBgn0051141 Length:253 Species:Drosophila melanogaster


Alignment Length:233 Identity:83/233 - (35%)
Similarity:128/233 - (54%) Gaps:9/233 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYNFFQVALSVWMVYEG---VVIWQ 90
            |...|.|::.||..||..|...|.|||:.|:|:.|.:.|..||.||:..::.|:..|   ::::|
  Fly    17 LATGPGPIIIILIGYLLVVFKAGRKFMEHREPYNLRKVLKYYNMFQIFYNIMMLLPGYYFMLVFQ 81

  Fly    91 YYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKNDRQVTFLHVYHHTVMPMIS 155
            .|::||..|.....|....|..:.|.||:.||.:||||:|.||||...|:|||||:||.:||...
  Fly    82 PYNFRCMTVLQQDHPLKNWERCISYAYYINKIVDLLDTVFCVLRKKYSQITFLHVFHHVLMPSAG 146

  Fly   156 WGTSKYYP-GGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWKKYITNLQMIQFCCAFIH- 218
            :...::|. ||...|:...|.||||.||:||:.:..|..::    ||:|:|.:||:||...|.| 
  Fly   147 YLIIRFYGYGGQLFFLCSFNVFVHIFMYAYYYSAIKGNTVR----WKRYLTLMQMLQFLLMFGHC 207

  Fly   219 QTQLLYTDCGYPRWSVCFTLPNAVFFYFLFNDFYQKSY 256
            ....:...|...:.::.....:|...:.:|.:||.:.|
  Fly   208 ALTAMQRQCTASQGTLFLVSCSATIMFIMFANFYFQCY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 80/227 (35%)
CG31141NP_732912.2 ELO 34..253 CDD:279492 76/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449600
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.