DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and Elo68alpha

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster


Alignment Length:253 Identity:96/253 - (37%)
Similarity:137/253 - (54%) Gaps:23/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FTDLADPRTNDWFLIKS--PLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYNFFQVALS 78
            |.|..|.||.:|.|:.|  .:|:|  |:.||..| .:.||:....||.:|...|..::...|.|:
  Fly    11 FPDQPDERTRNWPLVDSFWTVPVL--LSIYLLMV-RYAPKWTTRHKPLQLRAPLFCHSLAMVFLN 72

  Fly    79 VWMVYEGVVIWQY-------YSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKN 136
            .::..|     .|       |::.|||...|..|...|..:..:.:|::||.|..||.||:||:.
  Fly    73 GYICLE-----LYAATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFILRQK 132

  Fly   137 DRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWK 201
            ..|::|||||||:.|.:..|...|:.|.|.......||||||||||.||.||..||::|::||||
  Fly   133 WSQLSFLHVYHHSTMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQRFLWWK 197

  Fly   202 KYITNLQMIQFCCAFIHQTQLLYTDCGYPRWSVCFTLPNAVF---FYFLFNDFYQKSY 256
            :|:|.||::||...|...:|:|...|.|..|   .||..|::   |.|:|..||.:.|
  Fly   198 RYLTGLQLVQFTIIFFWASQMLVRGCEYGTW---ITLSMAIYSLPFLFMFGKFYMQKY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 87/235 (37%)
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 90/241 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473105
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.